PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV43501.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family HD-ZIP
Protein Properties Length: 312aa    MW: 34750.2 Da    PI: 8.375
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV43501.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.31.3e-18157211256
                 T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 rk+ +++keq  +Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  KZV43501.1 157 RKKLRLSKEQAAVLEETFKEHNTLNPKQKMALAKRLNLRPRQVEVWFQNRRARTK 211
                 788899***********************************************98 PP

2HD-ZIP_I/II127.36.5e-41157246191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  +kk+rlskeq+++LEe+F+e+++L+p++K++la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+L+r++++l++en+rL+kev+eLr +l
   KZV43501.1 157 RKKLRLSKEQAAVLEETFKEHNTLNPKQKMALAKRLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLRRCCENLTDENRRLQKEVNELR-AL 246
                  69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046182.3E-241135IPR006712HD-ZIP protein, N-terminal
SuperFamilySSF466891.37E-18147214IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.2E-18150216IPR009057Homeodomain-like
PROSITE profilePS5007117.443153213IPR001356Homeobox domain
SMARTSM003894.6E-15155217IPR001356Homeobox domain
PfamPF000465.0E-16157211IPR001356Homeobox domain
CDDcd000866.46E-15157214No hitNo description
PROSITE patternPS000270188211IPR017970Homeobox, conserved site
SMARTSM003402.6E-26213256IPR003106Leucine zipper, homeobox-associated
PfamPF021836.0E-11213247IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MADQDDGLGL GLSLSMRIPE KQHHNLNLSP PLAESSSPPR PPPSAASAVP VPVPFPLNLF  60
RSPLPFLQQP QQQQHKPSNN DAFQLSADRS GEPRSYFRGI DVNRAITVID CDEEAMVSSP  120
NSTVSSVSGK RSEREENDAE RASSSFEMED DGGEAARKKL RLSKEQAAVL EETFKEHNTL  180
NPKQKMALAK RLNLRPRQVE VWFQNRRART KLKQTEVDCE YLRRCCENLT DENRRLQKEV  240
NELRALKLSP QFYMNMSPPT TLTMCPQCER VAVSSASSSA ATSTAAASIN RQLQLPMASW  300
AAIISPQSVP RP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1205213RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011089804.11e-150PREDICTED: homeobox-leucine zipper protein HAT4-like
SwissprotP466023e-92HAT3_ARATH; Homeobox-leucine zipper protein HAT3
TrEMBLA0A068UP951e-123A0A068UP95_COFCA; Uncharacterized protein
STRINGPOPTR_0001s15490.11e-105(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60390.11e-82homeobox-leucine zipper protein 3